PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA44G00177
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 295aa    MW: 31152.5 Da    PI: 7.3457
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA44G00177genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.21.8e-081155345
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                     +W  e+d  + +a + +  +   +W++Ia+ ++ g++ +q+k+++ 
       AA44G00177 11 AWVREDDIAFERALANYTEEsedRWEKIAADVP-GKSVEQIKEHYE 55
                     7999**************99*************.**********95 PP

2Myb_DNA-binding43.19.6e-14118162347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E+ l++ + +++G+g+W++I+r    +Rt+ q+ s+ qky
       AA44G00177 118 AWTEDEHRLFLLGLEKYGKGDWRSISRNYVVTRTPTQVASHAQKY 162
                      6*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512937.86762IPR017884SANT domain
SMARTSM007171.8E-8860IPR001005SANT/Myb domain
PfamPF002493.4E-71155IPR001005SANT/Myb domain
CDDcd001673.18E-81158No hitNo description
Gene3DG3DSA:1.10.10.605.4E-51161IPR009057Homeodomain-like
SuperFamilySSF466891.15E-91265IPR009057Homeodomain-like
PROSITE profilePS5129417.624110167IPR017930Myb domain
SuperFamilySSF466891.12E-16113168IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-17115165IPR006447Myb domain, plants
SMARTSM007179.4E-11115165IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-10118161IPR009057Homeodomain-like
PfamPF002499.7E-12118162IPR001005SANT/Myb domain
CDDcd001678.29E-11118163No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MAVEEVSGGS AWVREDDIAF ERALANYTEE SEDRWEKIAA DVPGKSVEQI KEHYELLVED  60
VKRIESGCVP LPAYGSPEQS NGHGGDEGGS SKKGGNGHAT ESNQGKSKSD QERRKGIAWT  120
EDEHRLFLLG LEKYGKGDWR SISRNYVVTR TPTQVASHAQ KYFIRLNSMN KDRRRSSIHD  180
ITSVGNADVS TPQGPITGQN NNGAAVSGGA GGGGGSNKSA KQAASQAPAG PPPPMYGAPT  240
IGQPVGGVSA VGTPVNLSGP PHMAYGVHGG PVVPAAPMNM GQMPYTMPRT PTAHR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A1e-16974873RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00500DAPTransfer from AT5G08520Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006399351.11e-179hypothetical protein EUTSA_v10014203mg
SwissprotQ8S9H75e-61DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLE4MWT41e-179E4MWT4_EUTHA; mRNA, clone: RTFL01-15-N01
TrEMBLV4LAV41e-179V4LAV4_EUTSA; Uncharacterized protein
STRINGAT5G08520.11e-170(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35562861
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.11e-146MYB family protein